1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PMM1 Protein, Human (His)

The PMM1 protein is key to the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose and is essential for the mannosyl transfer reaction. Its enzymatic activity contributes to the biosynthesis of mannose-containing glycoconjugates, which are critical for protein glycosylation and related cellular processes. PMM1 Protein, Human (His) is the recombinant human-derived PMM1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PMM1 protein is key to the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose and is essential for the mannosyl transfer reaction. Its enzymatic activity contributes to the biosynthesis of mannose-containing glycoconjugates, which are critical for protein glycosylation and related cellular processes. PMM1 Protein, Human (His) is the recombinant human-derived PMM1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

The PMM1 Protein plays a pivotal role in the synthesis of GDP-mannose and dolichol-phosphate-mannose, crucial for various essential mannosyl transfer reactions. Its enzymatic activities contribute to the biosynthesis of mannose-containing glycoconjugates, playing a vital role in protein glycosylation and related cellular processes. Moreover, PMM1 may have an additional role in the degradation of glucose-1,6-bisphosphate in the ischemic brain, suggesting its involvement in metabolic responses to ischemic conditions. The multifaceted functions of PMM1 underscore its significance in cellular homeostasis and underline its potential contribution to glycosylation processes and metabolic adaptations in specific physiological contexts.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q92871 (M1-A262)

Gene ID
Molecular Construction
N-term
PMM1 (M1-A262)
Accession # Q92871
6*His
C-term
Synonyms
Phosphomannomutase 1; PMM 1; PMMH-22; PMM1; PMMH22
AA Sequence

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA

Molecular Weight

Approximately 49.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PMM1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PMM1 Protein, Human (His)
Cat. No.:
HY-P71216
Quantity:
MCE Japan Authorized Agent: