Plexin B1 Protein, Human (HEK293, mFc)

Plexin B1 protein is a receptor for SEMA4D and has a critical influence on GABAergic and inhibitory synapse development. It activates RHOA, leading to changes in the actin cytoskeleton, affecting axonal guidance, invasive growth and cell migration. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293 , with N-mFc labeled tag.

The Plexin B1 Protein acts as a receptor for SEMA4D, playing a critical role in GABAergic synapse development and mediating SEMA4A- and SEMA4D-dependent inhibitory synapse development. Additionally, it is involved in RHOA activation and subsequent changes in the actin cytoskeleton, contributing to axon guidance, invasive growth, and cell migration. It exists as a monomer and forms heterodimers with PLXNB2 after proteolytic processing. Plexin B1 binds to activated RAC1 and interacts with various proteins, including PLXNA1, ARHGEF11, ARHGEF12, ERBB2, MET, MST1R, RRAS, RHOD, RND1, NRP1, and NRP2. The interaction with SEMA4D promotes the binding of cytoplasmic ligands, emphasizing its intricate involvement in cellular signaling pathways and synaptic development.

Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5 μg/mL can bind human PLXNB1, the EC₅₀ is 246.8-883.4 ng/mL.

Human

HEK293

N-mFc

O43157 (L20-Q535)

5364  [NCBI]

Partial

LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ

Approximately 85 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.