1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc)

PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc)

Cat. No.: HY-P700568
Handling Instructions Technical Support

The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups.PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc) is the recombinant mouse-derived PLA2G7 protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups.PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc) is the recombinant mouse-derived PLA2G7 protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

Background

PLA2G7 protein, a lipoprotein-associated calcium-independent phospholipase A2, plays a pivotal role in phospholipid catabolism during inflammatory and oxidative stress responses. Operating at the lipid-aqueous interface, it hydrolyzes the ester bond of fatty acyl groups at the sn-2 position of phospholipids, with a specific preference for those carrying short-chain fatty acyl groups. Additionally, PLA2G7 can target phospholipids with long fatty acyl chains if they bear oxidized functional groups. The enzyme's versatility extends to inactivating platelet-activating factor (PAF), a potent pro-inflammatory signaling lipid, and hydrolyzing oxidatively truncated phospholipids, preventing their accumulation and uncontrolled pro-inflammatory effects. When associated with high-density lipoprotein (HDL) particles, PLA2G7 contributes to the hydrolysis of phospholipids containing long-chain fatty acyl hydroperoxides, safeguarding against potential oxylipin accumulation in the vascular wall. Furthermore, PLA2G7 catalyzes the release of F2-isoprostanes, serving as lipid biomarkers for cellular oxidative damage.

Species

Mouse

Source

HEK293

Tag

C-Myc;N-10*His

Accession

Q60963 (F22-N440)

Gene ID
Molecular Construction
N-term
10*His
PLA2G7 (F22-N440)
Accession # Q60963
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
PLA2G7; phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma); platelet-activating factor acetylhydrolase; LDL PLA2; PAFAH; LDL-PLA(2); gVIIA-PLA2; PAF 2-acylhydrolase; PAF acetylhydrolase; group-VIIA phospholipase A2; LDL-associated phospholipase A2; lipoprotein-associated phospholipase A2; 1-alkyl-2-acetylglycerophosphocholine esterase; 2-acetyl-1-alkylglycerophosphocholine esterase; PAFAD; LP-PLA2; LDL-PLA2;
AA Sequence

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Predicted Molecular Mass
51.9 kDa
Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc)
Cat. No.:
HY-P700568
Quantity:
MCE Japan Authorized Agent: