1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLA2G2D Protein, Mouse (HEK293, Fc)

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLA2G2D protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLA2G2D protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PLA2G2D Protein is a secretory calcium-dependent phospholipase A2 that primarily targets extracellular lipids, exerting anti-inflammatory and immunosuppressive functions. It hydrolyzes the ester bond of the fatty acyl group attached at the sn-2 position of phospholipids, with a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. In draining lymph nodes, it selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids (PUFAs) such as eicosapentaenoate and docosahexaenoate, which are precursors of the anti-inflammatory lipid mediators known as resolvins. During the resolution phase of acute inflammation, PLA2G2D Protein drives the synthesis of resolvin D1 derived from docosahexaenoate, which suppresses dendritic cell activation and T-helper 1 immune response. In addition to its catalytic activity, PLA2G2D Protein promotes the differentiation of regulatory T cells (Tregs) and participates in the maintenance of immune tolerance. It may also contribute to lipid remodeling of cellular membranes and the generation of lipid mediators involved in pathogen clearance. Moreover, PLA2G2D Protein displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane.

Biological Activity

Measured by its ability to hydrolyze 20 μΜ 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphocholine. The specific activity is 23.007-39.63 pmol/min/μg that at room temperature in kinetic mode for 5 minutes.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9WVF6-1 (G20-C144)

Gene ID
Molecular Construction
N-term
PLA2G2D (G20-C144)
Accession # Q9WVF6
hFc
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Group IID secretory phospholipase A2; GIID sPLA2; PLA2IID; Splash
AA Sequence

GLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4 or PBS, pH 7.4, 10% Glycerol, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLA2G2D Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLA2G2D Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76549
Quantity:
MCE Japan Authorized Agent: