1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLA2G16 Protein, Human (His)

The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine). PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine). PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PLA2G16 protein exhibits a dual functionality, encompassing both phospholipase A1/2 and acyltransferase activities. As a phospholipase, it displays both calcium-independent PLA1 and PLA2 activities, efficiently releasing fatty acids from the sn-1 or sn-2 position of glycerophospholipids, with a notable prevalence of PLA1 activity. Additionally, PLA2G16 acts as an O-acyltransferase, facilitating the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid, and as an N-acyltransferase, catalyzing the calcium-independent transfer of a fatty acyl group from phosphatidylcholine and other glycerophospholipids to the primary amine of phosphatidylethanolamine. This process forms N-acylphosphatidylethanolamine, a precursor for N-acylethanolamines. Beyond its lipid-modifying enzymatic activities, PLA2G16 plays a crucial role in organelle rupture and degradation during eye lens terminal differentiation, contributing to lens transparency. Moreover, in the context of microbial infection, it acts as a host factor for picornaviruses, facilitating viral genome release into the cytoplasm during early infection and serving as a cellular sensor of membrane damage at virus entry sites. This multifaceted functionality underscores the diverse roles of PLA2G16 in cellular and infection-related processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P53816 (D12-D132)

Gene ID
Molecular Construction
N-term
6*His
PLA2G16 (D12-D132)
Accession # P53816
C-term
Protein Length

Partial

Synonyms
Group XVI Phospholipase A1/A2; Adipose-Specific Phospholipase A2; AdPLA; H-Rev 107 Protein Homolog; HRAS-Like Suppressor 1; HRAS-Like Suppressor 3; HRSL3; HREV107-1; HREV107-3; Renal Carcinoma Antigen NY-REN-65; PLA2G16; HRASLS3; HREV107
AA Sequence

DLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD

Molecular Weight

14-17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 50 mM NaCl, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PLA2G16 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLA2G16 Protein, Human (His)
Cat. No.:
HY-P71211
Quantity:
MCE Japan Authorized Agent: