1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protein Kinase Inhibitor Peptide (PKI)
  4. cAMP-Dependent Protein Kinase A Inhibitor beta
  5. PKI-beta Protein, Human (His)

The PKI-β protein emerged as an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity. This protein operates at the molecular level, binding to the catalytic subunit of the enzyme after cAMP induces dissociation of its regulatory chain. PKI-beta Protein, Human (His) is the recombinant human-derived PKI-beta protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PKI-β protein emerged as an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity. This protein operates at the molecular level, binding to the catalytic subunit of the enzyme after cAMP induces dissociation of its regulatory chain. PKI-beta Protein, Human (His) is the recombinant human-derived PKI-beta protein, expressed by E. coli , with N-6*His labeled tag.

Background

The PKI-beta protein is an exceptionally potent competitive inhibitor of cAMP-dependent protein kinase activity. Functioning as a regulatory molecule, PKI-beta exerts its inhibitory action by interacting with the catalytic subunit of the enzyme, particularly after the cAMP-induced dissociation of its regulatory chains. This regulatory mechanism underscores the dynamic nature of cAMP-dependent protein kinase activity and the pivotal role of PKI-beta in modulating this signaling pathway. By tightly regulating the catalytic subunit, PKI-beta plays a crucial role in modulating cellular responses to cAMP signaling, contributing to the fine-tuning of intracellular processes influenced by this important kinase, such as those related to cell growth, metabolism, and gene expression.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9C010-1 (M1-K78)

Gene ID
Molecular Construction
N-term
6*His
PKI-beta (M1-K78)
Accession # Q9C010-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
cAMP-Dependent Protein Kinase Inhibitor Beta; PKI-beta; PKIB; PRKACN2
AA Sequence

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 20% glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PKI-beta Protein, Human (His)
Cat. No.:
HY-P71209
Quantity:
MCE Japan Authorized Agent: