1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PRKCE Protein, Human (His)

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.

Background

PKCE, a calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase, plays pivotal roles in regulating diverse cellular processes associated with cytoskeletal proteins, including cell adhesion, motility, migration, and cell cycle control. In cardiac fibroblasts, PKCE mediates angiotensin-2-induced integrin beta-1 (ITGB1) activation, facilitating cell adhesion to the extracellular matrix. It phosphorylates MARCKS, leading to PTK2/FAK activation and subsequent cardiomyocyte spreading. In mesenchymal cells, PKCE governs the directional transport of ITGB1 by phosphorylating vimentin (VIM). In epithelial cells, it associates with and phosphorylates keratin-8 (KRT8), influencing desmoplakin targeting at desmosomes and regulating cell-cell contact. Additionally, PKCE phosphorylates IQGAP1, promoting epithelial cell detachment prior to migration. In various contexts, such as HGF-induced cell migration, wound healing, and cytokinesis, PKCE demonstrates its versatility in coordinating complex cellular events. It also plays crucial roles in cardiac myocytes, nerve growth factor (NGF)-induced neurite outgrowth, and immune responses. Notably, PKCE influences prostate cancer cell invasion through phosphorylation of STAT3 and participates in the LPS-induced immune response via TICAM2/TRAM activation. In differentiating erythroid progenitors, PKCE is regulated by EPO, providing protection against TNFSF10/TRAIL-mediated apoptosis. Additionally, PKCE is implicated in insulin-induced phosphorylation and activation of AKT1, as well as the modulation of AKT pathway activation in cumulus cells through NLRP5/MATER phosphorylation.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q02156 (Q580-P737)

Gene ID
Molecular Construction
N-term
PKCE (Q580-P737)
Accession # Q02156
6*His
C-term
Protein Length

Partial

Synonyms
Protein Kinase C Epsilon Type; nPKC-Epsilon; PRKCE; PKCE
AA Sequence

QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Predicted Molecular Mass
19.6 kDa
Molecular Weight

Approximately 20 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PRKCE Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRKCE Protein, Human (His)
Cat. No.:
HY-P71208
Quantity:
MCE Japan Authorized Agent: