1. Recombinant Proteins
  2. Others
  3. PIST Protein, Human (His)

PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.

Background

PIST (PDZ domain-containing protein that interacts with Stx6) plays a crucial role in intracellular protein trafficking and degradation, as evidenced by its involvement in diverse cellular processes. It is implicated in the regulation of CFTR chloride currents and acid-induced ASIC3 currents, potentially modulating the cell surface expression of both channels. Moreover, PIST is associated with the intracellular trafficking of the ADR1B receptor and may contribute to autophagy regulation. In collaboration with MARCHF2, PIST mediates the ubiquitination and lysosomal degradation of CFTR, leading to its intracellular retention and subsequent lysosomal degradation. The protein forms homooligomers and engages in a network of interactions with various partners, including FZD5, FZD8, GRID2, BECN1, CSPG5, CLCN3, STX6, CFTR, ASIC3, GOLGA3, NLGN1, RHOQ, MARCHF2, ADRB1, and potentially CACNG2 and CCDC62, highlighting its multifaceted roles in cellular trafficking and signaling pathways.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9HD26-1 (I286-Y462)

Gene ID
Molecular Construction
N-term
His
PIST (I286-Y462)
Accession # Q9HD26-1
C-term
Protein Length

Partial

Synonyms
Golgi-associated PDZ and coiled-coil motif-containing protein; PIST; GOPC; CAL; FIG
AA Sequence

IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Molecular Weight

Approximately 25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PIST Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PIST Protein, Human (His)
Cat. No.:
HY-P73708
Quantity:
MCE Japan Authorized Agent: