1. Recombinant Proteins
  2. Others
  3. PIN4 Protein, Human (His)

PIN4 isoform 1 functions as a ribosomal RNA processing factor in ribosome biogenesis and interacts with tightly bent AT-rich stretches of double-stranded DNA. Meanwhile, PIN4 isoform 2 specifically binds to double-stranded DNA. PIN4 Protein, Human (His) is the recombinant human-derived PIN4 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PIN4 isoform 1 functions as a ribosomal RNA processing factor in ribosome biogenesis and interacts with tightly bent AT-rich stretches of double-stranded DNA. Meanwhile, PIN4 isoform 2 specifically binds to double-stranded DNA. PIN4 Protein, Human (His) is the recombinant human-derived PIN4 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PIN4 Protein, particularly Isoform 1, emerges as a crucial participant in ribosome biogenesis, functioning as a ribosomal RNA processing factor. Its involvement in this intricate process underscores its significance in the synthesis and maturation of ribosomes. Notably, Isoform 1 exhibits an affinity for tightly bent AT-rich stretches within double-stranded DNA, suggesting a role in DNA interaction and potential regulatory functions. On the other hand, Isoform 2 is characterized by its ability to bind to double-stranded DNA, indicating a distinct molecular role. The dual nature of PIN4 Protein isoforms, with one being intricately linked to ribosomal RNA processing and the other engaging with DNA, highlights its versatility and multifaceted contributions in cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y237-2 (M1-K156)

Gene ID
Molecular Construction
N-term
6*His
PIN4 (M1-K156)
Accession # Q9Y237-2
C-term
Protein Length

Full Length of Isoform-2

Synonyms
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; Parvulin-14; Parvulin-17; Peptidyl-prolyl cis-trans isomerase Pin4; Peptidyl-prolyl cis/trans isomerase EPVH; Rotamase Pin4; PIN4;
AA Sequence

MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PIN4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PIN4 Protein, Human (His)
Cat. No.:
HY-P71205
Quantity:
MCE Japan Authorized Agent: