1. Recombinant Proteins
  2. Receptor Proteins
  3. PILR-beta Protein, Human (HEK293, His)

PILR-β is part of a family of paired receptors that play a critical regulatory role in the immune system. PILR-β functions as an activating receptor and is thought to participate in cell signaling by binding to ITAM-bearing adapter molecules, suggesting its role in transmitting immune response signals. PILR-beta Protein, Human (HEK293, His) is the recombinant human-derived PILR-beta protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PILR-β is part of a family of paired receptors that play a critical regulatory role in the immune system. PILR-β functions as an activating receptor and is thought to participate in cell signaling by binding to ITAM-bearing adapter molecules, suggesting its role in transmitting immune response signals. PILR-beta Protein, Human (HEK293, His) is the recombinant human-derived PILR-beta protein, expressed by HEK293 , with N-His labeled tag.

Background

PILR-beta, a member of the paired receptors family, plays a crucial role in immune system regulation. As an activating receptor, PILRB is believed to engage in cellular signaling by associating with ITAM-bearing adapter molecules on the cell surface. This interaction suggests its involvement in transmitting signals that contribute to immune responses and modulation. The duality of activating and inhibitory receptors within the paired receptors family underscores their significance in finely tuning immune system activities.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized CL-P1 at 2μg/mL (100μL/well) can bind Biotinylated Human PILR-beta. The ED50 for this effect is 1.808 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized CL-P1 at 2μg/mL (100μL/well) can bind Biotinylated Human PILR-beta. The ED50 for this effect is 1.808 μg/mL.
Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q9UKJ0-1 (Q20-A189)

Gene ID
Molecular Construction
N-term
His
PILR-beta (Q20-A189)
Accession # Q9UKJ0-1
C-term
Protein Length

Extracellular Domain

Synonyms
Paired immunoglobulin-like type 2 receptor beta; Activating receptor PILR-beta; FDFACT; PP1551
AA Sequence

QPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTA

Molecular Weight

Approximately 30-33 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PILR-beta Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PILR-beta Protein, Human (HEK293, His)
Cat. No.:
HY-P77463
Quantity:
MCE Japan Authorized Agent: