1. Recombinant Proteins
  2. Receptor Proteins
  3. PILR-alpha Protein, Human (178a.a, HEK293, Fc)

PILR-alpha Protein, Human (178a.a, HEK293, Fc)

Cat. No.: HY-P78022
Handling Instructions Technical Support

PILR-α is a member of the paired receptor family and functions as an inhibitory signaling receptor in immune regulation. It inhibits signal transduction by recruiting the phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, blocking the phosphorylation of key signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, Fc) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PILR-α is a member of the paired receptor family and functions as an inhibitory signaling receptor in immune regulation. It inhibits signal transduction by recruiting the phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, blocking the phosphorylation of key signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, Fc) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PILR-alpha, belonging to the paired receptors family, functions as a cellular signaling inhibitory receptor with a role in immune system regulation. This receptor is presumed to exert its inhibitory effects by recruiting cytoplasmic phosphatases such as PTPN6/SHP-1 and PTPN11/SHP-2 through their SH2 domains, leading to signal transduction blockage via dephosphorylation of key signaling molecules. Additionally, PILR-alpha serves as a receptor for PIANP and, under conditions of microbial infection, acts as an entry co-receptor for herpes simplex virus 1. Its engagement in these molecular interactions highlights its versatile involvement in immune modulation and cellular responses to pathogens.

Biological Activity

Measured by its binding ability in a functional ELISA. ImmobilizedHuman PANP at 5 μg/ml (100 μL/well) can bind biotinylated Human PILR-alpha, The ED50 for this effect is 0.4769 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human PANP at 5 μg/ml (100 μL/well) can bind biotinylated Human PILR-alpha, The ED50 for this effect is 0.4769 μg/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9UKJ1-1 (Q20-A197)

Gene ID
Molecular Construction
N-term
PILR-alpha (Q20-A197)
Accession # Q9UKJ1-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
PILRA; FDF03; PILRalpha; PILR-alpha
AA Sequence

QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA

Molecular Weight

60-70 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalsoe.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PILR-alpha Protein, Human (178a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PILR-alpha Protein, Human (178a.a, HEK293, Fc)
Cat. No.:
HY-P78022
Quantity:
MCE Japan Authorized Agent: