1. Recombinant Proteins
  2. Others
  3. PHLDA2 Protein, Human (His)

PHLDA2 protein regulates placenta growth, potentially through its PH domain, which competes with other PH domain-containing proteins, hindering their binding to membrane lipids. PHLDA2 Protein, Human (His) is the recombinant human-derived PHLDA2 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PHLDA2 protein regulates placenta growth, potentially through its PH domain, which competes with other PH domain-containing proteins, hindering their binding to membrane lipids. PHLDA2 Protein, Human (His) is the recombinant human-derived PHLDA2 protein, expressed by E. coli , with C-6*His labeled tag.

Background

PHLDA2 protein is involved in the regulation of placenta growth. It likely exerts its effects through its PH domain, which competes with other PH domain-containing proteins, thereby hindering their binding to membrane lipids.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q53GA4 (M1-P152)

Gene ID
Molecular Construction
N-term
PHLDA2 (M1-P152)
Accession # Q53GA4
6*His
C-term
Protein Length

Full Length

Synonyms
Pleckstrin Homology-Like Domain Family A Member 2; Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein; Imprinted in Placenta and Liver Protein; Tumor-Suppressing STF cDNA 3 Protein; Tumor-Suppressing Subchromosomal Transferable Fragment
AA Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Predicted Molecular Mass
18.1 kDa
Molecular Weight

Approximately 14-25 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PHLDA2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PHLDA2 Protein, Human (His)
Cat. No.:
HY-P71202
Quantity:
MCE Japan Authorized Agent: