PHLDA2 Protein, Human (His)

PHLDA2 protein regulates placenta growth, potentially through its PH domain, which competes with other PH domain-containing proteins, hindering their binding to membrane lipids. PHLDA2 Protein, Human (His) is the recombinant human-derived PHLDA2 protein, expressed by E. coli , with C-6*His labeled tag.

PHLDA2 protein is involved in the regulation of placenta growth. It likely exerts its effects through its PH domain, which competes with other PH domain-containing proteins, thereby hindering their binding to membrane lipids.

Human

E. coli

C-6*His

Q53GA4 (M1-P152)

7262  [NCBI]

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

14-25 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.