1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. PHGDH Protein, Human (C-His)

PHGDH protein plays a key role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the first step in the phosphorylated L-serine biosynthetic pathway.PHGDH Protein, Human (C-His) is the recombinant human-derived PHGDH protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PHGDH protein plays a key role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the first step in the phosphorylated L-serine biosynthetic pathway.PHGDH Protein, Human (C-His) is the recombinant human-derived PHGDH protein, expressed by E.coli , with C-6*His labeled tag.

Background

PHGDH (Phosphoglycerate dehydrogenase) is an enzyme that plays a crucial role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the initial step in the phosphorylated L-serine biosynthesis pathway. This pathway is essential for the production of L-serine, a precursor for various cellular components, including nucleotides and proteins. In addition to its role in serine biosynthesis, PHGDH exhibits versatile enzymatic activities, including the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate. These additional activities suggest PHGDH's involvement in regulating metabolic flux and maintaining cellular redox balance. Understanding the functions of PHGDH provides insights into the intricate network of metabolic pathways and highlights its significance in supporting fundamental cellular processes.

Biological Activity

Measured by the ability to catalyze the oxidation of 3-phospho-D-glycerate.which can be measured by absorbance at 340 nm. The specific activity is 3159.161 pmol/min/µg, as measured under the described conditions.

Assay Procedure

Materials
Assay Buffer: 50 mM Tris, 800 mM NaCl, 0.2 mM DTT, pH 9.0
Recombinant Human Phosphoglycerate Dehydrogenase (rhPHGDH)
3-Phospho-D-Glyceric Acid (PGA), 200 mM stock in deionized water
beta-Nicotinamide Adenine Dinucleotide ( beta-NAD), 100 mM stock in deionized water
UV Plate
Plate Reader or equivalent

1.Dilute rhPHGDH to 5 μg/mL in Assay Buffer.
2.Prepare Substrate Mixture containing 20 mM PGA and 4 mM beta-NAD in Assay Buffer.
3.Load into a plate 50 μL of 5 μg/mL rhPHGDH, and start the reaction by adding 50 μL of Substrate Mixture. Include a Substrate Blank containing 50 μL of Assay Buffer and 50 μL of Substrate Mixture.
4.Read plate at 340 nm (absorbance) in kinetic mode for 5 minutes.
5.Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (OD/min) x well volume (L) x 1012 pmol/mol
ext. coeff** (M-1cm-1) x path corr.*** (cm) x amount of enzyme (μg)

*Adjusted for Substrate Blank.
**Using extinction coefficient 6220 M-1cm-1.
***Using the path correction 0.32 cm.

Per Well:
rhPHGDH: 0.25 μg
PGA: 10 mM
beta-NAD: 2 mM

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O43175 (M1-F533)

Gene ID
Molecular Construction
N-term
PHGDH (M1-F533)
Accession # O43175
6*His
C-term
Protein Length

Full Length

Synonyms
D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; PGDH3
AA Sequence

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Predicted Molecular Mass
57.5 kDa
Molecular Weight

Approximately 57 kDa

Structure/Form
Monomer
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PHGDH Protein, Human (C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PHGDH Protein, Human (C-His)
Cat. No.:
HY-P74633A
Quantity:
MCE Japan Authorized Agent: