1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His)

PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His)

Cat. No.: HY-P73710
Handling Instructions Technical Support

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2). Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2). Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

Background

The PGD2 Synthase/PTGDS protein serves as a catalyst for the conversion of PGH2 to PGD2, a prostaglandin that plays a crucial role in smooth muscle contraction/relaxation and acts as a potent inhibitor of platelet aggregation. It is implicated in various central nervous system (CNS) functions, including sedation, NREM sleep, PGE2-induced allodynia, and potentially acts as an anti-apoptotic factor in oligodendrocytes. Additionally, this protein binds to small non-substrate lipophilic molecules such as biliverdin, bilirubin, retinal, retinoic acid, and thyroid hormone, potentially functioning as a scavenger for harmful hydrophobic compounds and acting as a secretory transporter for retinoids and thyroid hormones. It is likely involved in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor, and blood-testis barriers. Furthermore, it plays significant roles in the maturation and maintenance of the central nervous system and male reproductive system. It is also engaged in the maturation of mast cells through its involvement in the PLA2G3-dependent pathway, where PLA2G3 secreted by immature mast cells acts on neighboring fibroblasts upstream of PTGDS, leading to the synthesis of PGD2, which ultimately promotes mast cell maturation and degranulation via PTGDR.

Biological Activity

Measured by its ability to catalyse the conversion of PGH2 to PGD2. The specific activity is 4.878 pg/min/µg that incubate at 25 ºC for 1 minutes.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

NP_032989.2 (Q25-E189)

Gene ID
Molecular Construction
N-term
PGD2 Synthase/PTGDS (Q25-E189)
Accession # NP_032989.2
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Prostaglandin-H2 D-isomerase; L-PGDS; PGDS2; PTGDS
AA Sequence

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

Molecular Weight

Approximately 26-32 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73710
Quantity:
MCE Japan Authorized Agent: