1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. LDH Protein, P. falciparum (His)

The pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the purine metabolism salvage pathway of the malaria-causing parasite Plasmodium falciparum. LDH Protein, P. falciparum (His) is the recombinant LDH protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the purine metabolism salvage pathway of the malaria-causing parasite Plasmodium falciparum. LDH Protein, P. falciparum (His) is the recombinant LDH protein, expressed by E. coli , with C-His labeled tag.

Background

pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the salvage pathway of purine metabolism in the malaria-causing parasite Plasmodium falciparum. pfHPRT catalyzes the conversion of hypoxanthine and guanine to their respective nucleotide forms, in the presence of phosphoribosyl pyrophosphate (PRPP). This enzymatic activity is essential for the parasite's survival, as it provides a means to generate purine nucleotides required for DNA and RNA synthesis. Due to its involvement in purine salvage, pfHPRT has been explored as a potential target for antimalarial drug development. Inhibition of pfHPRT could disrupt the parasite's purine metabolism, leading to the depletion of nucleotides and subsequent parasite death. Understanding the structure, function, and regulation of pfHPRT may contribute to the development of novel strategies to combat malaria.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Others

Source

E. coli

Tag

C-His

Accession

Q76NM3/XP_001349989.1 (M1-A316)

Gene ID

814112  [NCBI]

Molecular Construction
N-term
LDH (M1-A316)
Accession # Q76NM3/XP_001349989.1
His
C-term
Protein Length

Full Length

Synonyms
L-lactate dehydrogenase; PF3D7_1324900
AA Sequence

MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA

Molecular Weight

Approximately 34.9 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LDH Protein, P. falciparum (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDH Protein, P. falciparum (His)
Cat. No.:
HY-P77134
Quantity:
MCE Japan Authorized Agent: