PfLDH Protein, P. falciparum (His)

The pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the purine metabolism salvage pathway of the malaria-causing parasite Plasmodium falciparum. PfLDH Protein, P. falciparum (His) is the recombinant PfLDH protein, expressed by E. coli , with C-His labeled tag.

pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the salvage pathway of purine metabolism in the malaria-causing parasite Plasmodium falciparum. pfHPRT catalyzes the conversion of hypoxanthine and guanine to their respective nucleotide forms, in the presence of phosphoribosyl pyrophosphate (PRPP). This enzymatic activity is essential for the parasite's survival, as it provides a means to generate purine nucleotides required for DNA and RNA synthesis. Due to its involvement in purine salvage, pfHPRT has been explored as a potential target for antimalarial drug development. Inhibition of pfHPRT could disrupt the parasite's purine metabolism, leading to the depletion of nucleotides and subsequent parasite death. Understanding the structure, function, and regulation of pfHPRT may contribute to the development of novel strategies to combat malaria.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Others

E. coli

C-His

Q76NM3 (M1-A316)

814112  [NCBI]

MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA

Approximately 34.9 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.