1. Recombinant Proteins
  2. Others
  3. PFDN4 Protein, Human (His)

The PFDN4 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN4 Protein, Human (His) is the recombinant human-derived PFDN4 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PFDN4 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN4 Protein, Human (His) is the recombinant human-derived PFDN4 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PFDN4 protein exhibits precise binding to cytosolic chaperonin (c-CPN), facilitating the targeted transfer of proteins to this chaperone. Additionally, PFDN4 binds to nascent polypeptide chains, actively promoting their proper folding within a cellular environment characterized by numerous competing pathways for nonnative proteins. As a heterohexamer composed of two PFD-alpha type and four PFD-beta type subunits, PFDN4 plays a crucial role in cellular protein homeostasis. Notably, it interacts with URI1 in a phosphorylation-dependent manner, and this interaction is modulated in a growth-dependent fashion, emphasizing the dynamic nature of its cellular functions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NQP4 (M1-S134)

Gene ID

5203  [NCBI]

Molecular Construction
N-term
6*His
PFDN4 (M1-S134)
Accession # Q9NQP4
C-term
Synonyms
Prefoldin Subunit 4; Protein C-1; PFDN4; PFD4
AA Sequence

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

Molecular Weight

18-20 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PFDN4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PFDN4 Protein, Human (His)
Cat. No.:
HY-P71198
Quantity:
MCE Japan Authorized Agent: