1. Recombinant Proteins
  2. Others
  3. PFDN2 Protein, Human (His)

The PFDN2 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN2 Protein, Human (His) is the recombinant human-derived PFDN2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PFDN2 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN2 Protein, Human (His) is the recombinant human-derived PFDN2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PFDN2 protein exhibits specific binding affinity to cytosolic chaperonin (c-CPN), facilitating the targeted transfer of proteins to this chaperone. Furthermore, PFDN2 interacts with nascent polypeptide chains, actively promoting their proper folding within an intricate cellular environment with numerous competing pathways for nonnative proteins. As a heterohexamer, PFDN2 comprises two PFD-alpha type and four PFD-beta type subunits. It plays a crucial role as part of the PAQosome complex, collaborating with other essential components such as R2TP complex members (RUVBL1, RUVBL2, RPAP3, and PIH1D1) and URI complex members (PFDN6, PDRG1, UXT, and URI1), as well as ASDURF, POLR2E, and DNAAF10/WDR92. This complex is integral to the biogenesis of various protein complexes. Notably, PFDN2 engages in phosphorylation-dependent interactions with URI1, demonstrating a growth-dependent manner of interaction.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9UHV9 (M1-S154)

Gene ID
Molecular Construction
N-term
6*His
PFDN2 (M1-S154)
Accession # Q9UHV9
C-term
Protein Length

Full Length

Synonyms
Prefoldin Subunit 2; PFDN2; PFD2
AA Sequence

MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

Molecular Weight

Approximately 19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PFDN2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PFDN2 Protein, Human (His)
Cat. No.:
HY-P71197
Quantity:
MCE Japan Authorized Agent: