1. Recombinant Proteins
  2. Others
  3. PFDN1 Protein, Mouse (His)

The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

Background

HLA-DPB1, a pivotal player in the immune response, is instrumental in presenting peptides derived from antigens to CD4 T-cells. Operating within the endocytic route of antigen-presenting cells (APCs), HLA-DPB1's peptide binding cleft accommodates a range of 10-30 residue peptides. This MHC class II molecule is particularly involved in the exogenous antigen presentation pathway, where peptides from degraded proteins are presented on the cell surface. The complex process involves the association of three MHC class II molecules with a CD74 trimer in the endoplasmic reticulum (ER), forming a heterononamer. Upon entry into the endosomal/lysosomal system, CD74 undergoes sequential degradation, culminating in the release of a small fragment known as CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM, which stabilizes MHC class II molecules until high-affinity antigenic peptides are bound. The resultant MHC II molecule-peptide complex is then transported to the cell membrane surface for recognition. Notably, HLA-DO in B-cells and primary dendritic cells (DCs) regulate the interaction between HLA-DM and MHC class II molecules. The lysosomal microenvironment, characterized by increased acidification, plays a crucial role in regulating antigen loading into MHC II molecules, impacting proteolysis and efficient peptide loading. The heterodimeric structure of HLA-DPB1, composed of an alpha and a beta subunit, contributes to its multifaceted role in antigen presentation.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q9CQF7 (M1-Q122)

Gene ID

67199  [NCBI]

Molecular Construction
N-term
His
PFDN1 (M1-Q122)
Accession # Q9CQF7
C-term
Synonyms
Prefoldin subunit 1; PFDN1; PFD1
AA Sequence

MAASVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PFDN1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PFDN1 Protein, Mouse (His)
Cat. No.:
HY-P76541
Quantity:
MCE Japan Authorized Agent: