1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. Platelet Factor 4 Variant 1
  6. PF4V1 Protein, Human (HEK293, Fc)

PF4V1, also known as CXCL4L1, is a non-allelic variant of CXCL4. PF4V1 is a platelet-associated chemokine, and it binds to heparin is much weaker than in the close homolog PF4/CXCL4. PF4V1 is an inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis. PF4V1 is involved in inflammation, angiogenesis, and cancer. PF4V1 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 104 amino acids (M1-S104).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PF4V1, also known as CXCL4L1, is a non-allelic variant of CXCL4. PF4V1 is a platelet-associated chemokine, and it binds to heparin is much weaker than in the close homolog PF4/CXCL4. PF4V1 is an inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis. PF4V1 is involved in inflammation, angiogenesis, and cancer[1][2]. PF4V1 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 104 amino acids (M1-S104).

Background

PF4V1 (CXCL4L1), a CXC chemokine, is originally isolated from thrombin stimulated platelets. Full-length human CXCL4L1/PF-4var is comprised of 104 amino acids. CXCL4L1 seems to be constitutively released by platelets, smooth muscle cells, human aortic and coronary smooth muscle cells and is inducible in monocytes, endothelial and osteosarcoma cells by inflammatory mediators. CXCL4L1 plays a role in inflammation, angiogenesis and cancer[1][2][3].
CXCL4 and its non-allelic variant CXCL4L1 are both platelet-derived chemokines. The mature CXCL4L1 protein is composed of 70 amino acids and differs in only three amino acids situated in the carboxy-terminal part of the protein (Pro58 ) Leu, Lys66 ) Glu, Leu67 ) His; CXCL4 ) CXCL4L1). Due to these changes in amino acids, CXCL4L1 is supposed to have a different secondary structure and a lower affinity for heparin. In vivo, weak to strong expression of CXCL4L1 was detected in sarcoma tissue by immunohistochemistry. CXCL4L1 functions as a chemoattractant for activated T cells, NK cells and immature dendritic cells. CXCL4L1 is a more potent angiostatic chemokine compared to CXCL4. Compared to CXCL4, CXCL4L1 is less likely to form heterodimers with fFGF2 and VEGF or to compete for GAG-binding[1][2][3].
CXCL4L1 is found to be a more potent angiostatic and anti-tumoral chemokine compared to CXCL4 in various in vitro and in vivo assays. CXCL4L1 (10 ng/mL) is more potent than CXCL4 in inhibiting CXCL8/IL-8- or FGF-2-induced chemotaxis of endothelial cells. Further, CXCL4L1 is induced in human osteosarcoma cells (1.5-3.5 ng/mL) by IL-1β, TNF-α and IL-17A. CXCL4L1 is expressed and functioned in several cancers such as ovarian carcinoma, breast cancer, and pancreatic cancer. Additionally, CXCL4L1 is also strongly detected in colorectal carcinoma tissue samples, whereas CXCL4L1 staining in squamous cell carcinoma of the esophagus is weak to negative[1][2][3].

In Vitro

Recombinant human CXCL4L1 protein (3, 1 or 3 ng/mL; for 2 hours) inhibits signal transduction and migration of human microvascular endothelial cells towards VEGF and FGF-2 in HMVEC. Recombinant human CXCL4L1 (1 ng/mL; for 5 min) protein counteracts FGF-2-induced ERK phosphorylation in HMVEC[4].

In Vivo

Recombinant human PF4V1 protein (25 µg/mous; intratumorally injection; three times per week; for 21 days) suppresses the growth of prostate cancer in nude mice model[2].

Biological Activity

Measured by its ability to inhibit proliferation of HUVEC human umbilical vein endothelial cells. The ED50 of this effect is 37.49 ng/mL, corresponding to a specific activity is 2.67×104 units/mg.

  • Measured by its ability to inhibit proliferation of HUVEC human umbilical vein endothelial cells. The ED50 of this effect is 37.49 ng/ml, corresponding to a specific activity is 2.67×104 units/mg.
Species

Human

Source

HEK293

Tag

C-mFc

Accession

NP_002611.1 (F31-S104)

Gene ID
Molecular Construction
N-term
PF4V1 (F31-S104)
Accession # NP_002611.1
mFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Platelet factor 4 variant; CXCL4L1; PF4var1; SCYB4V1
AA Sequence

FARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES

Predicted Molecular Mass
34.6 kDa
Molecular Weight

Approximately 38.7 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PF4V1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PF4V1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76539
Quantity:
MCE Japan Authorized Agent: