1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. Platelet Factor 4
  6. PF-4/CXCL4 Protein, Mouse (HEK293, Fc)

PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation. PF-4/CXCL4 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 76 amino acids (V30-S105).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation[1][2]. PF-4/CXCL4 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 76 amino acids (V30-S105).

Background

CXCL4, also known as PF-4 (platelet factor-4), is a member of the CXC chemokine family produced by cells of the megakaryocytic lineage.  In megakaryocytes CXCL4 is synthesized, enclosed in vesicles, and transferred to the α granules from which it is secreted following platelet activation. CXCL4 expression is also found in microglia, monocytes and activated T-cells[1][2].
Mature human CXCL4 shares 70% amino acid sequence identity with mouse and rat CXCL4.
CXCL4 is stored in secretory granules of blood platelets and is released in response to protein kinase C and Rac1 activation. Platelets are considered to be the major cellular source of CXCL4. In the α-granules of blood platelets CXCL4 is kept as a tetramer bound to two molecules of chondroitin sulphate. CXCL4 does not possess an ELR acid sequence at its amino terminus and therefore does not bind to CXCR1 or CXCR2. CXCL4 moderates the effects of heparin-like molecules on the endothelial cell surface of blood vessels, thereby inhibiting local antithrombin III activity, which results in a procoagulant role of CXCL4. CXCL4 exhibits antiangiogenic properties in vitro and in vivo and inhibits tumor neovascularization through a variety of mechanisms. First, CXCL4 is able to interact directly with angiogenic growth factors, such as FGFs and VEGF, and inhibits their interaction with the cell surface receptor. Second, CXCL4 may bind proteoglycans and interfere with the proteoglycan-bystander effect on growth factor activity. Furthermore, a cell surface receptor that is expressed by human endothelial cells (ECs) in a cell cycle-dependent manner11 and mediates the antiangiogenic effects of CXCL4 has been recently identified and named as CXCR3-B. CXCL4 has been shown to modulate the proliferation, phenotype and function of immune cells. For instance, CXCL4 has been reported to promote monocyte survival and macrophage activation. CXCL4 induces migration of activated T lymphocytes[1][2][3].
CXCL4 shows pleiotropic biological functions. Firstly, CXCL4 activates platelets, modulates platelet aggregation and stimulates release of α-granule proteins. CXCL4 has a role in heparin-induced thrombocytopenia (HIT). Secondly, CXCL4 inhibits endothelial cell proliferation and migration, leading to suppression of angiogenesis. Thirdly, CXCL4 expresses immunomodulatory activities, such as down-regulation of IFN- production by type 1 T-helper (Th1) cells and up-regulation of IL-4, IL-5, and IL-13 in type 2 T-helper (Th2) cells. Fourthly, CXCL4 influences hematopoiesis, inhibiting megakaryocytopoiesis and the proliferation of committed erythroid and granulocyte-macrophage colonies, as well as of primitive CD34+ progenitors. Moreover, CXCL4 is also highly upregulated in plasmacytoid dendritic cells (pDCs) in systemic sclerosis and dendritic cells (DCs) after severe trauma[1][2][3].

In Vitro

Recombinant mouse CXCL4 protein (2.5, 5, 25, or 50 µg/kg/day) to myocardial infarction (MI) mice at 24 h post-MI by osmotic mini-pump. CXCL4 infusion dramatically reduces 7 day post-MI survival. CXCL4 infusion also increases Ccr4 and Itgb4 and decreased Adamts8 gene levels in the infarct region[4].

In Vivo

Recombinant mouse CXCL4 (5 μg/mL; for 4 h) elicites macrophages to express pro-inflammatory cytokines in peritoneal macrophages. CXCL4 significantly up-regulates the expression of Ccl3, Ccl5, Il1β, and Il6[4].
Recombinant mouse CXCL4 (20-2000 ng/mL; for 24 h) leads to dose-dependent increase in proliferation in stellate cells. CXCL4 also induces the directed migration of stellate cells in a modified Boyden chamber. Incubation of stellate cells with Cxcl4 for 24 hours leads to increased expression of Ccl5 mRNA and Ccl5 protein[5].

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9Z126 (V30-S105)

Gene ID
Molecular Construction
N-term
CXCL4 (V30-S105)
Accession # Q9Z126
hFc
C-term
Synonyms
PF-4; Oncostatin-A; CXCL4; SCYB4; Iroplact; MGC138298
AA Sequence

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Molecular Weight

40-50 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, 200mM L-Arginine (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PF-4/CXCL4 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PF-4/CXCL4 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78289
Quantity:
MCE Japan Authorized Agent: