1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human

Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human

Cat. No.: HY-P70047
Handling Instructions Technical Support

CYPA protein, a peptidyl prolyl cis-trans isomerase, has proinflammatory activity by stimulating activation of NF-kappa-B and ERK, JNK, and p38 MAP kinases. It may act as a mediator between the human SARS coronavirus nucleoprotein and BSG/CD147 during the virus' invasion of host cells. Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human is the recombinant human-derived Peptidyl-prolyl cis-trans isomerase A/CYPA protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CYPA protein, a peptidyl prolyl cis-trans isomerase, has proinflammatory activity by stimulating activation of NF-kappa-B and ERK, JNK, and p38 MAP kinases. It may act as a mediator between the human SARS coronavirus nucleoprotein and BSG/CD147 during the virus' invasion of host cells. Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human is the recombinant human-derived Peptidyl-prolyl cis-trans isomerase A/CYPA protein, expressed by E. coli , with tag free.

Background

Peptidyl-prolyl cis-trans isomerase A (CYP A) catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. This enzyme plays a multifaceted role, exerting a strong chemotactic effect on leukocytes through the activation of its membrane receptor BSG/CD147, initiating a signaling cascade culminating in MAPK/ERK activation. Additionally, CYP A activates endothelial cells (ECs) in a pro-inflammatory manner, inducing NF-kappa-B and MAP-kinase signaling, and upregulating adhesion molecules. It induces apoptosis in ECs, promoting FOXO1-dependent expression of CCL2 and BCL2L11. In response to oxidative stress, CYP A initiates proapoptotic and antiapoptotic signaling in ECs. It negatively regulates MAP3K5/ASK1 kinase activity and is necessary for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, regulating TARDBP binding to RNA. CYP A also plays a crucial role in platelet activation and aggregation, regulates calcium mobilization, and facilitates integrin ITGA2B:ITGB3 bidirectional signaling. Moreover, it inhibits replication of influenza A virus and may act as a mediator between the SARS coronavirus nucleoprotein and BSG/CD147 during virus invasion of host cells.

Biological Activity

Measured by its ability to inhibit calcineurin phosphatase activity in the presence of Cyclosporin A. The IC50 for inhibition of calcineurin activity is 234.46 nM, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P62937-1 (M1-E165)

Gene ID
Molecular Construction
N-term
CYPA (M1-E165)
Accession # P62937-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
rHuPeptidyl-prolyl cis-trans isomerase A/CYPA; Peptidyl-prolyl cis-trans isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A; SP18; PPIA; CYPA
AA Sequence

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Molecular Weight

16-18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human
Cat. No.:
HY-P70047
Quantity:
MCE Japan Authorized Agent: