Pellino-1 Protein, Human

Pellino-1 protein is an E3 ubiquitin ligase that links ubiquitin to substrate proteins. Pellino-1 Protein, Human is the recombinant human-derived Pellino-1 protein, expressed by E. coli, with tag free.

Pellino-1, functioning as an E3 ubiquitin ligase, orchestrates the covalent attachment of ubiquitin moieties onto substrate proteins, particularly playing a crucial role in the Toll-like receptor (TLR) and interleukin-1 (IL-1) signaling pathways through its interaction with the complex containing IRAK kinases and TRAF6. Notably, Pellino-1 mediates 'Lys-63'-linked polyubiquitination of IRAK1, a pivotal step facilitating subsequent NF-kappa-B activation. Additionally, it exhibits a regulatory role in cell fate decisions, as it catalyzes 'Lys-48'-linked polyubiquitination of RIPK3, leading to its proteasome-dependent degradation, with a preference for the 'Thr-182' phosphorylated form of RIPK3. Intriguingly, Pellino-1 negatively modulates necroptosis by downregulating RIPK3 expression through its ubiquitin ligase activity. Furthermore, Pellino-1 extends its regulatory influence by mediating 'Lys-63'-linked ubiquitination of RIPK1, thereby contributing to the intricate modulation of cellular responses within these critical signaling pathways.

Human

E. coli

Tag Free

Q96FA3 (F2-D418)

57162

Partial

FSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

Greater than 80% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.