1. Recombinant Proteins
  2. Others
  3. PEA15 Protein, Human

The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free.

Background

The PEA15 protein exerts diverse regulatory functions in cellular processes, including blocking Ras-mediated inhibition of integrin activation and modulating the ERK MAP kinase cascade. PEA15 plays a pivotal role in inhibiting the activities of RPS6KA3 by sequestering it in the cytoplasm, thereby regulating key cellular pathways. Additionally, PEA15 serves as a potent inhibitor of both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Its involvement extends to the regulation of glucose transport, wherein PEA15 controls the content of SLC2A1 glucose transporters on the plasma membrane and modulates the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface. Functionally, PEA15 forms transient interactions with PLD1 and PLD2, further contributing to its intricate regulatory network. Notably, PEA15 engages in direct interactions with key cellular players such as RPS6KA3, MAPK3, MAPK1, CASP8, and FADD, underscoring its multifaceted role in cellular signaling and homeostasis.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q15121 ( M1-A130)

Gene ID
Molecular Construction
N-term
PEA15 ( M1-A130)
Accession # Q15121
C-term
Protein Length

Full Length

Synonyms
Astrocytic Phosphoprotein PEA-15; 15 kDa Phosphoprotein Enriched in Astrocytes; Phosphoprotein Enriched in Diabetes; PED; PEA15
AA Sequence

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

Predicted Molecular Mass
15.3 kDa
Molecular Weight

Approximately 12-16 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PEA15 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PEA15 Protein, Human
Cat. No.:
HY-P71195
Quantity:
MCE Japan Authorized Agent: