1. Recombinant Proteins
  2. Others
  3. PDRG1 Protein, Human (His)

As a component of the PAQosome complex, the PDRG1 protein may play a role in chaperone-mediated protein folding. PAQosome is composed of multiple protein complexes, including PDRG1, and coordinates the biogenesis of multiple protein complexes. PDRG1 Protein, Human (His) is the recombinant human-derived PDRG1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As a component of the PAQosome complex, the PDRG1 protein may play a role in chaperone-mediated protein folding. PAQosome is composed of multiple protein complexes, including PDRG1, and coordinates the biogenesis of multiple protein complexes. PDRG1 Protein, Human (His) is the recombinant human-derived PDRG1 protein, expressed by E. coli , with N-His labeled tag.

Background

The PDRG1 protein is suggested to potentially play a role in chaperone-mediated protein folding. It is identified as a component of the PAQosome complex, responsible for the biogenesis of several protein complexes. The PAQosome consists of R2TP complex members RUVBL1, RUVBL2, RPAP3, and PIH1D1, along with URI complex members PFDN2, PFDN6, PDRG1, UXT, and URI1, as well as ASDURF, POLR2E, and DNAAF10/WDR92. The presence of PDRG1 in the PAQosome complex highlights its potential involvement in coordinating the assembly and maturation of various protein complexes, emphasizing its significance in cellular processes related to protein folding and complex biogenesis. The intricate composition of the PAQosome underscores the need for further investigation to elucidate the specific functions and molecular interactions of PDRG1 within this dynamic cellular complex.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NUG6 (M1-G133)

Gene ID
Molecular Construction
N-term
His
PDRG1 (M1-G133)
Accession # Q9NUG6
C-term
Protein Length

Full Length

Synonyms
p53 and DNA damage-regulated protein 1; PDRG1; C20orf126; PDRG
AA Sequence

MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG

Molecular Weight

Approximately 12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDRG1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDRG1 Protein, Human (His)
Cat. No.:
HY-P76537
Quantity:
MCE Japan Authorized Agent: