1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-BB
  6. PDGF-BB Protein, Human

PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. PDGF-BB Protein, Human improves collagenase-induced Achilles tendinopathy in rats.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. PDGF-BB Protein, Human improves collagenase-induced Achilles tendinopathy in rats.

Background

Recombinant Human Platelet-derived Growth Factor-BB is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. Platelet-derived growth factor-BB (PDGF-BB) is primarily secreted from platelet α-granules and is the most active PDGF isoform in bone and other connective tissue as it can bind to all known PDGF receptors. PDGF-BB plays an important role in bone regeneration by inducing mitogenesis, chemotaxis, extracellular matrix formation, and vascularization[1]. Recombinant Human Platelet-derived Growth Factor-BB (rhPDGF-BB) accelerates tendon healing by improving matrix remodeling, increased collagen synthesis, and increased cell proliferation. Recombinant Human Platelet-derived Growth Factor-BB is also efficacious in a non-ruptured, degenerated, tendinopathy model. Furthermore, Recombinant Human Platelet-derived Growth Factor-BB addresses chronic tendinopathies by inducing proliferation and migration of progenitor cells and tenocytes, which stimulate structural repair of the degenerated tendon[2].

In Vitro

PDGF-BB Protein, Human (7.5 ng/mL-7.5 µg/mL) significantly enhances the proliferation of human foreskin fibroblasts[4].
PDGF-BB Protein, Human (10 ng/mL; 0-24 h) promotes the migration of rat bone marrow mesenchymal stem cells (rBM MSC)[5].
PDGF-BB Protein, Human (50 ng/mL; 2-4 h) upregulates the gene expression of CCL2 and CCL7 in mouse 10T1/2 cells[6].

In Vivo

PDGF-BB Protein, Human (3-10 μg; intra-tendon injection) improves maximum load-to-rupture and stiffness in a rat Achilles tendinopathy model induced by collagenase[2].
PDGF-BB Protein, Human (3 mg/wound; topical application; once daily; 10 d) does not accelerate wound closure, re-epithelialization, or collagen deposition in a splinted full-thickness skin wound model in db/db diabetic mice[4].

Biological Activity

The ED50 is ≤11 ng/mL as measured by murine Balb/c 3T3 cells.

  • Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 1.81 ng/mL, corresponding to a specific activity is 5.54×105 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01127-1 (S82-T190)

Gene ID
Molecular Construction
N-term
PDGF-BB (S82-T190)
Accession # P01127-1
C-term
Protein Length

Full Length of PDGFB

Synonyms
rHuPDGF-BB; PDGF-2; GDGF; ODGF; SIS; SSV
AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Predicted Molecular Mass
12.4 kDa
Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 20 mM NaAc-HAc, pH 4.5 or 50 mM Tris-HCl, 200 mM NaCl, 500 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PDGF-BB Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-BB Protein, Human
Cat. No.:
HY-P7055
Quantity:
MCE Japan Authorized Agent: