1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-A
  6. PDGF-AA Protein, Rat (P.pastoris, His)

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Background

PDGF-AA Protein emerges as a pivotal growth factor orchestrating key aspects of embryonic development, including cell proliferation, migration, survival, and chemotaxis. Recognized for its potency as a mitogen for mesenchymal cells, PDGF-AA assumes essential roles in various physiological processes, such as the formation of lung alveolar septa, development of the gastrointestinal tract, Leydig cell maturation, spermatogenesis, oligodendrocyte development, and myelination in the spinal cord and cerebellum. Furthermore, PDGF-AA stands as a crucial contributor to wound healing dynamics. Its signaling intricacies involve modulation through heterodimer formation with PDGFB, underscoring its versatility in regulatory mechanisms. Structurally, PDGF-AA adopts a homodimeric configuration, characterized by an antiparallel disulfide-linked dimer. Additionally, it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, showcasing the complexity of its molecular interactions. Furthermore, PDGF-AA demonstrates an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

Biological Activity

Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblasts. The ED50 for this effect is 5 - 15 ng/mL.

Species

Rat

Source

P. pastoris

Tag

N-His

Accession

P28576-2/NP_036933.2 (S87-R196)

Gene ID
Molecular Construction
N-term
His
PDGF-AA (S87-R196)
Accession # P28576-2/NP_036933.2
C-term
Synonyms
Platelet-derived growth factor subunit A; PDGF-1; PDGF-A; Rpa1
AA Sequence

RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

Molecular Weight

17-22 kDa & 25-45 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDGF-AA Protein, Rat (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-AA Protein, Rat (P.pastoris, His)
Cat. No.:
HY-P73720
Quantity:
MCE Japan Authorized Agent: