1. Recombinant Proteins
  2. Others
  3. PDCD10 Protein, Human

The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.

Background

PDCD10 Protein emerges as a multifunctional regulator, exerting its influence on diverse cellular processes. Notably, it plays a pivotal role in promoting cell proliferation, modulating apoptotic pathways, and enhancing mitogen-activated protein kinase activity and STK26 activity. Beyond its involvement in cell cycle dynamics, PDCD10 is essential for cell migration, contributing to the normal structure and assembly of the Golgi complex. Furthermore, it proves critical for KDR/VEGFR2 signaling by increasing the stability of KDR/VEGFR2 and preventing its breakdown. PDCD10's significance extends to embryonic development, where it is required for normal cardiovascular development, angiogenesis, vasculogenesis, and hematopoiesis. Operating as a homodimer, PDCD10 engages in a network of protein-protein interactions, including associations with CCM2, PXN, STK25, STK26, STK24, GOLGA2, and KDR/VEGFR2, highlighting its intricate involvement in cellular signaling pathways and structural processes. The intricate interplay of PDCD10 in these molecular networks underscores its versatile role in cellular homeostasis and warrants further investigation to unravel the detailed mechanisms governing its diverse functions.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9BUL8 (M1-Al212 )

Gene ID
Molecular Construction
N-term
PDCD10 (M1-Al212 )
Accession # Q9BUL8
C-term
Protein Length

Full Length

Synonyms
Programmed Cell Death Protein 10; Cerebral Cavernous Malformations 3 Protein; TF-1 Cell Apoptosis-Related Protein 15; PDCD10; CCM3; TFAR15
AA Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Predicted Molecular Mass
24.9 kDa
Molecular Weight

Approximately 28 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PDCD10 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDCD10 Protein, Human
Cat. No.:
HY-P71190
Quantity:
MCE Japan Authorized Agent: