1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. B7-DC/PD-L2/CD273 B7-DC/PD-L2/CD273 B7-DC/PD-L2/CD273
  5. PD-L2 Protein, Rat (HEK293, His)

Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 is consist of one IgV and one IgC domain, and is involved in the costimulatory signal, negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner. Interaction of Pdcd1lg2 with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. The interaction of Pdcd1lg2 with PD-1 boosts tolerance of T-cells, induces an inhibitory effect on T-cell activation/proliferation, increases the conversion of T helper cells into Foxp3+ Treg cells, and prevents cytolysis of T cell in cancerous cells, and consequently causes cancer growth and suppresses the immune system. Pdcd1lg2 expresses chiefly on APCs such as non-hematopoietic tissues, myeloid dendritic cells, and macrophages, while Pdcd1lg is active in external side of plasma membrane and is a biomarker of pulmonary tuberculosis[1][2][3][4].

Biological Activity

1.Measured by its binding ability in a functional ELISA.Immobilized rat PDCD1LG2-His at 10 μg/mL (100 μl/well) can bind rat PDCD1-Fc, The EC50 of rat PDCD1-Fc is 15-35 ng/mL.
2.Measured by its binding ability in a functional ELISA. When Recombinant Rat PD-L2 is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Rat PD-1 that produces 50% optimal binding response is 0.2136 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rat PD‑L2 is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Rat PD-1 that produces 50% optimal binding response is 0.2136 μg/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

D4AAV6 (L20-R219)

Gene ID
Molecular Construction
N-term
PD-L2 (L20-R219)
Accession # D4AAV6
His
C-term
Protein Length

Partial

Synonyms
Programmed cell death 1 ligand 2; PD-1 ligand 2; PD-L2; B7-DC; CD273
AA Sequence

LFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPR

Molecular Weight

Approximately 35.7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PD-L2 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-L2 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73371
Quantity:
MCE Japan Authorized Agent: