1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. B7-DC/PD-L2/CD273 B7-DC/PD-L2/CD273 B7-DC/PD-L2/CD273
  5. PD-L2 Protein, Mouse (200a.a, HEK293, Fc)

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (200a.a, HEK293, Fc) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (200a.a, HEK293, Fc) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The PD-L2 Protein assumes a critical role in the costimulatory signal necessary for T-cell proliferation and IFNG production, operating in a PDCD1-independent manner. While its interaction with PDCD1 can inhibit T-cell proliferation by impeding cell cycle progression and cytokine production, PD-L2 itself is intricately involved in fostering these immune responses. The dynamic interplay between PD-L2 and PDCD1 highlights the regulatory mechanisms at play, emphasizing the protein's dual role in promoting or inhibiting T-cell activation based on its interactions within the immune signaling network.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9WUL5 (L20-R219)

Gene ID
Molecular Construction
N-term
PD-L2 (L20-R219)
Accession # Q9WUL5
hFc
C-term
Synonyms
Programmed cell death 1 ligand 2; Pdcd1lg2; PD-1 ligand 2; PD-L2; PDCD1 ligand 2; B7-DC; CD273
AA Sequence

LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

Molecular Weight

70-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PD-L2 Protein, Mouse (200a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-L2 Protein, Mouse (200a.a, HEK293, Fc)
Cat. No.:
HY-P72491
Quantity:
MCE Japan Authorized Agent: