1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PCSK9 Protein, Macaca nemestrina (HEK293, His)

PCSK9 Protein, Macaca nemestrina (HEK293, His)

Cat. No.: HY-P70966
Handling Instructions Technical Support

The PCSK9 protein controls plasma cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2 to promote their degradation. It prevents LDLR recycling and directs it to lysosomes for degradation. PCSK9 induces LDLR ubiquitination, inhibits APOB degradation, disposes of BACE1 intermediates, reduces ENaC surface expression, and regulates neuronal apoptosis through LRP8/APOER2. PCSK9 Protein, Macaca nemestrina (HEK293, His) is the recombinant cynomolgus-derived PCSK9 protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PCSK9 protein controls plasma cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2 to promote their degradation. It prevents LDLR recycling and directs it to lysosomes for degradation. PCSK9 induces LDLR ubiquitination, inhibits APOB degradation, disposes of BACE1 intermediates, reduces ENaC surface expression, and regulates neuronal apoptosis through LRP8/APOER2. PCSK9 Protein, Macaca nemestrina (HEK293, His) is the recombinant cynomolgus-derived PCSK9 protein, expressed by HEK293, with C-6*His labeled tag.

Background

PCSK9 protein plays a crucial role in maintaining the balance of plasma cholesterol levels. It interacts with low-density lipoprotein receptor family members such as LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2, promoting their degradation within acidic compartments of the cell. Through a non-proteolytic mechanism, it enhances the degradation of hepatic LDLR via a clathrin LDLRAP1/ARH-mediated pathway, preventing its recycling from endosomes to the cell surface and directing it to lysosomes for degradation. Additionally, PCSK9 can induce ubiquitination of LDLR, leading to its subsequent degradation. It also inhibits the intracellular degradation of APOB, independent of LDLR, by affecting the autophagosome/lysosome pathway. Moreover, PCSK9 is involved in the early secretory pathway by disposing of non-acetylated intermediates of BACE1. It further regulates epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by reducing ENaC surface expression, primarily through increased proteasomal degradation. Finally, PCSK9 modulates neuronal apoptosis by regulating the levels of LRP8/APOER2 and related anti-apoptotic signaling pathways.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

A8T662 (Q31-Q152&S153-Q692)

Gene ID

105495119  [NCBI]

Molecular Construction
N-term
PCSK9 (Q31-Q152&S153-Q692)
Accession # A8T662
6*His
C-term
Protein Length

Full Length

Synonyms
Proprotein Convertase Subtilisin/Kexin Type 9; Proprotein Convertase 9; PC9; Subtilisin/Kexin-Like Protease PC9; PCSK9
AA Sequence

QEDEDGDYEELVLALRSEEDGLADAPEHGATATFHRCAKDPWRLPGTYVVVLKEETHRSQSERTARRLQAQAARRGYLTKILHVFHHLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ&SIPWNLERITPARYRADEYQPPKGGSLVEVYLLDTSIQSDHREIEGRVMVTDFESVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGAGLRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVFNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSRSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHRAGWQLFCRTVWSAHSGPTRMATAVARCAQDEELLSCSSFSRSGKRRGERIEAQGGKRVCRAHNAFGGEGVYAIARCCLLPQVNCSVHTAPPAGASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVIVACEDGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVAAVAICCRSRHLVQASQELQ

Molecular Weight

(16-21)&(55-77) kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.1 M Arg, 0.1 M Glu, 20% glycerol, 0.01% Tween 20, 5% trehalose, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PCSK9 Protein, Macaca nemestrina (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PCSK9 Protein, Macaca nemestrina (HEK293, His)
Cat. No.:
HY-P70966
Quantity:
MCE Japan Authorized Agent: