PANP/C12orf53 Protein, Human (HEK293, Fc)

PANP/C12orf53 Protein acts as a neural tissue ligand for PILRA, indicating its potential role in immune regulation in this context. PANP/C12orf53 Protein, Human (HEK293, Fc) is the recombinant human-derived PANP/C12orf53 protein, expressed by HEK293 , with C-hFc labeled tag.

PANP/C12orf53 Protein functions as a ligand specifically for PILRA in neural tissues, suggesting its potential involvement in immune regulation within this context.

Measured by the ability of the immobilized protein to support the adhesion of Neuro‑2A mouse neuroblastoma cells. The ED₅₀ for this effect is 33.88 ng/mL, corresponding to a specific activity is 2.952×10⁴ units/mg.

Human

HEK293

C-hFc

Q8IYJ0-1 (S32-P178)

196500  [NCBI]

Extracellular Domain

SSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDP

Approximately 50-65 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.