1. Recombinant Proteins
  2. Enzymes & Regulators
  3. PADI2 Protein, Cynomolgus (sf9, His)

The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag.

Background

Peptidyl arginine deiminase 2 (PADI2) is an enzyme that catalyzes the deimination of arginine residues in proteins. This post-translational modification, also known as citrullination, involves the conversion of arginine to citrulline through the removal of an amino group. Citrullination plays a crucial role in various biological processes, including the regulation of gene expression, immune responses, and the formation of certain protein structures. PADI2-mediated deimination is implicated in the pathogenesis of autoimmune diseases such as rheumatoid arthritis, where citrullinated proteins are often targets of the immune system. It has to succinctly outline PADI2's catalytic function in introducing citrulline modifications to arginine residues, emphasizing its role in modulating protein structure and function.

Species

Cynomolgus

Source

sf9 insect cells

Tag

N-His

Accession

A0A2K5TST4 (M1-P665)

Gene ID

/

Molecular Construction
N-term
His
PADI2 (M1-P665)
Accession # A0A2K5TST4
C-term
Protein Length

Full Length

Synonyms
PADI2; PAD-H19; KIAA0994; PAD2; PDI2
AA Sequence

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSERVRVEVMRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEMVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCDLKVCFQYINRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFEPVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDKDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP

Predicted Molecular Mass
77.6 kDa
Molecular Weight

Approximately 75-85 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

Greater than 95% as determined by reduced SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PADI2 Protein, Cynomolgus (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PADI2 Protein, Cynomolgus (sf9, His)
Cat. No.:
HY-P78575
Quantity:
MCE Japan Authorized Agent: