1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Platelet CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. P-Selectin/CD62P Selectin
  5. P-Selectin/CD62P
  6. P-Selectin Protein, Rhesus Macaque (HEK293, Fc)

P-Selectin Protein, Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P73688
Handling Instructions Technical Support

P-Selectin Protein, Rhesus Macaque (HEK293, His) is a member of the selectin family of cell adhesion molecules. P-selectin (CD62P) has an N-terminal lectin domain, an epidermal growth factor motif, (generally) nine regulatory protein repeats, a transmembrane section and a short intracytoplasmic tail. P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes. P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin. P-Selectin Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived P-Selectin protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

P-Selectin Protein, Rhesus Macaque (HEK293, His) is a member of the selectin family of cell adhesion molecules. P-selectin (CD62P) has an N-terminal lectin domain, an epidermal growth factor motif, (generally) nine regulatory protein repeats, a transmembrane section and a short intracytoplasmic tail. P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes. P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin[1][2][3]. P-Selectin Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived P-Selectin protein, expressed by HEK293 , with C-hFc labeled tag.

Background

P-selectin is an adhesion molecule located in the platelet a granule and Weibel-Palade body of endothelial cells. P-selectin mediates the rolling of blood cells on the surface of the endothelium and initiates the attachment of leukocytes circulating in the blood to platelets, endothelial cells,and other leukocytes at sites of tissue injury and inflammation. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin which is responsible for leukocyte rolling on active endothelium. Glycoprotein GPIb mediates platelet adhesion to subendothelium at sites of injury and the rolling of inactivated platelets on its activated surface. Sulfatides are ligands for P-selectin, which plays a role in platelet aggregation and adhesion[2].

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

XP_001094728.1 (W42-A771)

Gene ID
Molecular Construction
N-term
P-Selectin (W42-A771)
Accession # XP_001094728.1
hFc
C-term
Protein Length

Partial

Synonyms
P-selectin; GMP-140; LECAM3; PADGEM; CD62P; Selp
AA Sequence

WTYHYSTKAYSWNTSRKYCQNRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPSKLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFVLVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCIHPLAAFAYGSNCKFECQLGYRVRGLDTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFICDEGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHGEFNVGSTCHFSCNKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPGTFGFNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Predicted Molecular Mass
106.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

P-Selectin Protein, Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
P-Selectin Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P73688
Quantity:
MCE Japan Authorized Agent: