1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. OXT Protein, Human (P.pastoris, His)

OXT, or oxytocin, induces physiological effects by binding to neurophysin 1 and interacting with the oxytocin receptor (OXTR). This interaction results in smooth muscle contraction in the uterus and mammary gland, crucial for labor and breastfeeding, respectively, by modulating OXTR activity. OXT Protein, Human (P.pastoris, His) is the recombinant human-derived OXT protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OXT, or oxytocin, induces physiological effects by binding to neurophysin 1 and interacting with the oxytocin receptor (OXTR). This interaction results in smooth muscle contraction in the uterus and mammary gland, crucial for labor and breastfeeding, respectively, by modulating OXTR activity. OXT Protein, Human (P.pastoris, His) is the recombinant human-derived OXT protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

OXT, or oxytocin, exerts its physiological effects through binding to neurophysin 1 and subsequently interacting with the oxytocin receptor (OXTR). This interaction leads to the contraction of smooth muscles in both the uterus and mammary gland. Oxytocin plays a crucial role in mediating uterine contractions during labor and facilitating milk ejection during breastfeeding by modulating the activity of the OXTR.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P01178 (A32-R125)

Gene ID
Molecular Construction
N-term
6*His
OXT (A32-R125)
Accession # P01178
C-term
Protein Length

Full Length of Mature Protein

Synonyms
OXT; OT; Oxytocin-neurophysin 1
AA Sequence

AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Molecular Weight

Approximately 16 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4 or 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

OXT Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OXT Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71766
Quantity:
MCE Japan Authorized Agent: