1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands OX40 Ligand
  5. OX40 Ligand
  6. OX40 Ligand/TNFSF4 Protein, Rabbit (P. pastoris, His-Myc)

OX40 Ligand/TNFSF4 Protein, Rabbit (P. pastoris, His-Myc)

Cat. No.: HY-P700501
Handling Instructions Technical Support

OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (P. pastoris, His-Myc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by P. pastoris , with C-6*His, Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (P. pastoris, His-Myc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by P. pastoris , with C-6*His, Myc labeled tag.

Background

The OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, exerting its role as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its interaction with TNFRSF4 plays a pivotal role in enhancing the immune response by promoting the activation and expansion of T-cells. Through this engagement, OX40 Ligand contributes to the intricate regulation of T-cell-mediated immune responses, serving as a key mediator in modulating T-cell functions for effective and controlled immune activation.

Species

Rabbit

Source

P. pastoris

Tag

C-6*His;Myc

Accession

O02765 (Q45-P187)

Gene ID
Protein Length

Extracellular Domain

Synonyms
Tumor necrosis factor ligand superfamily member 4; Glycoprotein Gp34; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; TNFSF4; CD252; TXGP1
AA Sequence

QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Predicted Molecular Mass
19.8 kDa
Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

OX40 Ligand/TNFSF4 Protein, Rabbit (P. pastoris, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OX40 Ligand/TNFSF4 Protein, Rabbit (P. pastoris, His-Myc)
Cat. No.:
HY-P700501
Quantity:
MCE Japan Authorized Agent: