1. Recombinant Proteins
  2. Others
  3. Outer membrane protein F/OmpF Protein, E.coli (His, myc)

Outer membrane protein F/OmpF Protein, E.coli (His, myc)

Cat. No.: HY-P72279
Handling Instructions Technical Support

Outer membrane protein F (OmpF) facilitates the formation of pores, enabling the passive diffusion of small molecules across the bacterial outer membrane. Beyond its role in membrane permeability, OmpF serves as a crucial receptor for the bacteriophage T2 and is considered the primary receptor for colicin E5, playing a probable role in the mechanisms associated with these interactions. Outer membrane protein F/OmpF Protein, E.coli (His, myc) is the recombinant E. coli-derived Outer membrane protein F/OmpF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Outer membrane protein F (OmpF) facilitates the formation of pores, enabling the passive diffusion of small molecules across the bacterial outer membrane. Beyond its role in membrane permeability, OmpF serves as a crucial receptor for the bacteriophage T2 and is considered the primary receptor for colicin E5, playing a probable role in the mechanisms associated with these interactions. Outer membrane protein F/OmpF Protein, E.coli (His, myc) is the recombinant E. coli-derived Outer membrane protein F/OmpF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

The Outer membrane protein F (OmpF) plays a crucial role in bacterial physiology as it forms pores facilitating the passive diffusion of small molecules across the outer membrane. Serving as a key component in membrane permeability, OmpF contributes to the uptake of essential nutrients and substances by the bacterial cell. Furthermore, OmpF serves as a receptor for the bacteriophage T2, allowing the virus to recognize and infect the bacterial host. Additionally, there is a probable association between OmpF and colicin E5, where OmpF is identified as the major receptor for this bacteriocin. This dual functionality of OmpF in nutrient uptake and its interactions with bacteriophages and colicins underscores its significance in bacterial membrane dynamics and host-defense mechanisms.

Species

E.coli

Source

E. coli

Tag

C-Myc;N-10*His

Accession

P02931 (A23-F362)

Gene ID

945554  [NCBI]

Molecular Construction
N-term
10*His
OmpF (A23-F362)
Accession # P02931
C-term
Synonyms
Outer membrane protein B; Outer membrane protein IA
AA Sequence

AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF

Molecular Weight

Approximately 44.1 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Outer membrane protein F/OmpF Protein, E.coli (His, myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Outer membrane protein F/OmpF Protein, E.coli (His, myc)
Cat. No.:
HY-P72279
Quantity:
MCE Japan Authorized Agent: