1. Recombinant Proteins
  2. Others
  3. Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc)

Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc)

Cat. No.: HY-P72286
Handling Instructions Technical Support

Outer membrane protein C (OmpC) acts as a pore-forming protein that facilitates the passive diffusion of small molecules across the bacterial outer membrane. Notably, in Klebsiella pneumoniae, OmpC has been shown to bind the C1Q component and activate the classical pathway of the complement system. Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc) is the recombinant Outer membrane protein C/OmpC protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Outer membrane protein C (OmpC) acts as a pore-forming protein that facilitates the passive diffusion of small molecules across the bacterial outer membrane. Notably, in Klebsiella pneumoniae, OmpC has been shown to bind the C1Q component and activate the classical pathway of the complement system. Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc) is the recombinant Outer membrane protein C/OmpC protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

The Outer membrane protein C (OmpC) is a homotrimeric protein integral to the outer membrane of bacteria, forming pores that enable the passive diffusion of small molecules. In Klebsiella pneumoniae, OmpC demonstrates additional functionality by binding to the C1Q component, thereby activating the classical pathway of the complement system. This interaction implicates OmpC in the modulation of the host immune response, showcasing its relevance beyond membrane permeability. The homotrimeric structure of OmpC underscores its stability and efficiency in facilitating the transport of molecules across the bacterial outer membrane.

Species

Others

Source

E. coli

Tag

N-10*His;C-Myc

Accession

Q48473 (A22-F363)

Gene ID

/

Molecular Construction
N-term
10*His
OmpC (A22-F363)
Accession # Q48473
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Outer membrane porin C; Outer membrane protein C; Porin OmpC; Porin ompk36
AA Sequence

AEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKGKDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLVYQF

Molecular Weight

Approximately 45.0 kDa

Purity
  • Greater than 96% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc)
Cat. No.:
HY-P72286
Quantity:
MCE Japan Authorized Agent: