1. Recombinant Proteins
  2. Others
  3. OBP2B Protein, Human (HEK293, His)

The OBP2B protein may be involved in the binding and transport of small hydrophobic volatile molecules, suggesting a role in molecular recognition and transport, especially for lipophilic compounds. Its specificity implies involvement in sensory or signaling pathways in which recognition and transport of volatile compounds are crucial. OBP2B Protein, Human (HEK293, His) is the recombinant human-derived OBP2B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The OBP2B protein may be involved in the binding and transport of small hydrophobic volatile molecules, suggesting a role in molecular recognition and transport, especially for lipophilic compounds. Its specificity implies involvement in sensory or signaling pathways in which recognition and transport of volatile compounds are crucial. OBP2B Protein, Human (HEK293, His) is the recombinant human-derived OBP2B protein, expressed by HEK293 , with C-His labeled tag.

Background

The OBP2B protein is implicated in the probable binding and transportation of small hydrophobic volatile molecules. This suggests a role in molecular recognition and transport processes, particularly for small, lipophilic compounds. The specificity of OBP2B for such molecules implies its potential involvement in sensory or signaling pathways where the recognition and transport of volatile compounds are crucial. Further exploration of the ligands bound by OBP2B and the physiological contexts in which it operates will contribute to a more comprehensive understanding of its function in molecular transport and potential implications in cellular responses to environmental cues.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9NPH6-1 (L16-H170)

Gene ID

29989  [NCBI]

Molecular Construction
N-term
OBP2B (L16-H170)
Accession # Q9NPH6-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Odorant-binding protein 2b; OBPIIb
AA Sequence

LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH

Molecular Weight

Approximately 20 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

OBP2B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OBP2B Protein, Human (HEK293, His)
Cat. No.:
HY-P77111
Quantity:
MCE Japan Authorized Agent: