1. Recombinant Proteins
  2. Others
  3. OBCAM/OPCML Protein, Mouse (HEK293, His)

OBCAM/OPCML Protein uniquely binds opioids, especially in the presence of acidic lipids, indicating a potential role in cellular interactions and signaling related to opioid binding. This dual affinity suggests involvement in cell-contact processes where opioids and acidic lipids are present, highlighting its significance in modulating cellular responses to external stimuli and contributing to opioid-related signaling pathways. OBCAM/OPCML Protein, Mouse (HEK293, His) is the recombinant mouse-derived OBCAM/OPCML protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OBCAM/OPCML Protein uniquely binds opioids, especially in the presence of acidic lipids, indicating a potential role in cellular interactions and signaling related to opioid binding. This dual affinity suggests involvement in cell-contact processes where opioids and acidic lipids are present, highlighting its significance in modulating cellular responses to external stimuli and contributing to opioid-related signaling pathways. OBCAM/OPCML Protein, Mouse (HEK293, His) is the recombinant mouse-derived OBCAM/OPCML protein, expressed by HEK293 , with C-His labeled tag.

Background

The OBCAM/OPCML Protein demonstrates a unique ability to bind opioids, particularly in the presence of acidic lipids, suggesting a potential role in cellular interactions and signaling related to opioid binding. This characteristic implies that OBCAM/OPCML may be involved in cell-contact processes where opioids and acidic lipids are present. The protein's dual affinity for opioids and acidic lipids underscores its potential significance in modulating cellular responses to external stimuli and highlights its potential contribution to opioid-related signaling pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized mouse OBCAM at 0.5 μg/mL (100 μL/well) can bind biotinylated human LSAMP. The ED50 for this effect is 0.9972 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized mouse OBCAM at 0.5 μg/mL (100 μL/well) can bind biotinylated human LSAMP .The ED50 for this effect is 0.9972 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q6DFY2 (T30-V313)

Gene ID
Molecular Construction
N-term
OPCML (T30-V313)
Accession # Q6DFY2
His
C-term
Synonyms
Opioid-binding protein/cell adhesion molecule; OBCAM; OPCML; IGLON1
AA Sequence

TFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGV

Molecular Weight

Approximately 44-55 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

OBCAM/OPCML Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OBCAM/OPCML Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77114
Quantity:
MCE Japan Authorized Agent: