1. Recombinant Proteins
  2. Enzymes & Regulators
  3. NUDT5 Protein, Human (His)

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg Get quote
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.

Background

NUDT5, a versatile enzyme, exhibits dual functionality by acting as an ADP-sugar pyrophosphatase in the absence of diphosphate and catalyzing ATP synthesis in the presence of diphosphate. In the absence of diphosphate, NUDT5 demonstrates hydrolytic activity towards various modified nucleoside diphosphates, including ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP, and 8-oxo-dGDP. Additionally, it can hydrolyze other nucleotide sugars with low activity. When dephosphorylated at Thr-45, NUDT5 facilitates ATP synthesis in the nucleus by converting ADP-ribose to ATP and ribose 5-phosphate. This nuclear ATP generation is crucial for energy-consuming chromatin remodeling events. Despite its diverse enzymatic activities, NUDT5 does not play a role in U8 snoRNA decapping activity, although it exhibits binding affinity for U8 snoRNA.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9UKK9 (E2-F219)

Gene ID
Molecular Construction
N-term
His
NUDT5 (E2-F219)
Accession # Q9UKK9
C-term
Synonyms
ADP-sugar pyrophosphatase; Nudix motif 5; hNUDT5; YSA1H; NUDIX5
AA Sequence

ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Molecular Weight

30-35 kDa.

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4(Normally 8% trehalose is added as protectant before lyophilization) or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NUDT5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NUDT5 Protein, Human (His)
Cat. No.:
HY-P76525
Quantity:
MCE Japan Authorized Agent: