1. Recombinant Proteins
  2. Others
  3. Nucleophosmin/Npm1 Protein, Human (150a.a, His)

Nucleophosmin/Npm1 Protein, Human (150a.a, His)

Cat. No.: HY-P74681
Handling Instructions Technical Support

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (150a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Nucleophosmin/Npm1 Protein, Human (150a.a, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (150a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Background

Nucleophosmin/Npm1 protein stands at the crossroads of diverse cellular processes, orchestrating pivotal roles in ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, and the intricate regulation of cell proliferation. This multifaceted protein emerges as a key player in the cellular orchestra, binding to ribosomes to facilitate their nuclear export, associating with nucleolar ribonucleoprotein structures, and interacting with single-stranded nucleic acids. Functioning as a chaperonin, Npm1 collaborates with core histones H3, H2B, and H4, and stimulates the endonuclease activity of APEX1 on double-stranded DNA while inhibiting its activity on single-stranded RNA. Beyond its involvement in nucleolar processes, Npm1 regulates centrosome and centriole duplication, counteracts apoptosis, and modulates the transcriptional activity of MYC target genes in conjunction with MYC. The intricate web of interactions involves partners such as NSUN2, SENP3, RPS10, NEK2, ROCK2, BRCA2, RPGR, CENPW, EIF2AK2/PKR, CEBPA, DDX31, NOP53, LRRC34, RRP1B, NPM3, ALKBH2, and TTF1, underscoring the complexity and versatility of Npm1 in cellular functions.

Species

Human

Source

E. coli

Tag

N-His

Accession

P06748-1 (M9-L158)

Gene ID
Molecular Construction
N-term
His
Npm1 (M9-L158)
Accession # P06748-1
C-term
Protein Length

Partial

Synonyms
Npm1; Nucleophosmin; NPM; Numatrin
AA Sequence

MSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKL

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 20% Acetonitrile, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Nucleophosmin/Npm1 Protein, Human (150a.a, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nucleophosmin/Npm1 Protein, Human (150a.a, His)
Cat. No.:
HY-P74681
Quantity:
MCE Japan Authorized Agent: