1. Recombinant Proteins
  2. Others
  3. NRN1L Protein, Human (HEK293, His)

NRN1L Protein is encoded by nrn1l gene in extracellular and enhances both neurite growth and neuronal survival. NRN1L protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer. NRN1L Protein belongs to the neuritin (Nrn1) family. NRN1 is involved in neural development, synaptic plasticity, and synapse maturation. NRN1L Protein, Human (HEK293, His) is the recombinant human-derived NRN1L protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NRN1L Protein is encoded by nrn1l gene in extracellular and enhances both neurite growth and neuronal survival. NRN1L protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer. NRN1L Protein belongs to the neuritin (Nrn1) family. NRN1 is involved in neural development, synaptic plasticity, and synapse maturation[1][2]. NRN1L Protein, Human (HEK293, His) is the recombinant human-derived NRN1L protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Neuritin (Nrn1) is a glycophosphatidylinositol-linked protein. Nrn1 is expressed in various human tissues including the nervous system, specifically in the lipid rafts of cell membranes. Nrn1 promotes neurite outgrowth, dendritic growth, neuronal migration, and synapse maturation in neurons of the visual cortex; it also regulates synaptic plasticity, apoptosis of peripheral neurons and spinal axon regeneration and promotes recovery following cerebral ischemia[2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q496H8 (A36-A139)

Gene ID
Molecular Construction
N-term
NRN1L (A36-A139)
Accession # Q496H8
6*His
C-term
Synonyms
Neuritin-like protein; NRN1L; UNQ2446/PRO5725
AA Sequence

AAGPNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA

Molecular Weight

14&16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NRN1L Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRN1L Protein, Human (HEK293, His)
Cat. No.:
HY-P71172
Quantity:
MCE Japan Authorized Agent: