1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. NR4A2 Protein, Human (P.pastoris, His)

NR4A2, a crucial transcriptional regulator, is vital for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons. It plays a pivotal role in the expression of key genes (SLC6A3, SLC18A2, TH, DRD2) essential for mdDA neuron development. Interactions with SFPQ, NCOR2, SIN3A, HADC1, and PER2 contribute to its regulatory functions in mdDA neuron development, with the NCOR2 interaction influenced by the absence of PITX3. NR4A2 Protein, Human (P.pastoris, His) is the recombinant human-derived NR4A2 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NR4A2, a crucial transcriptional regulator, is vital for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons. It plays a pivotal role in the expression of key genes (SLC6A3, SLC18A2, TH, DRD2) essential for mdDA neuron development. Interactions with SFPQ, NCOR2, SIN3A, HADC1, and PER2 contribute to its regulatory functions in mdDA neuron development, with the NCOR2 interaction influenced by the absence of PITX3. NR4A2 Protein, Human (P.pastoris, His) is the recombinant human-derived NR4A2 protein, expressed by P. pastoris , with N-His labeled tag.

Background

NR4A2, a key transcriptional regulator, holds significance in the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. Its pivotal role extends to the expression of crucial genes like SLC6A3, SLC18A2, TH, and DRD2, which are essential for the development of mdDA neurons. NR4A2 interacts with proteins such as SFPQ, NCOR2, SIN3A, and HADC1, with the interaction with NCOR2 being influenced by the absence of PITX3. Additionally, NR4A2 engages with PER2, contributing to its regulatory functions in the intricate processes associated with mdDA neuron development.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

P43354 (M1-F598)

Gene ID
Molecular Construction
N-term
His
NR4A2 (1M-598F)
Accession # P43354
C-term
Synonyms
HZF 3; HZF3; Immediate-early response protein NOT; Transcriptionally-inducible nuclear receptor
AA Sequence

MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Molecular Weight

Approximately 68.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NR4A2 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NR4A2 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71765
Quantity:
MCE Japan Authorized Agent: