1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Natriuretic Peptides B (NPPB)
  5. NPPB Protein, Human (His, solution)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His, solution) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His, solution) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

Background

TRIM5 protein serves as a capsid-specific restriction factor, impeding the infection of non-host-adapted retroviruses by blocking viral replication early in the viral life cycle, specifically after viral entry but before reverse transcription. Beyond its role as a capsid-specific restriction factor, TRIM5 also functions as a pattern recognition receptor, activating innate immune signaling in response to the retroviral capsid lattice. Upon binding to the viral capsid, TRIM5 triggers its E3 ubiquitin ligase activity, collaborating with the UBE2V1-UBE2N complex to generate 'Lys-63'-linked polyubiquitin chains. This ubiquitination process leads to the autophosphorylation of the MAP3K7/TAK1 complex, resulting in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, ultimately initiating an innate immune response in the infected cell. TRIM5's restrictive capabilities extend to various retroviruses, including N-tropic murine leukemia virus (N-MLV), equine infectious anemia virus (EIAV), simian immunodeficiency virus of macaques (SIVmac), feline immunodeficiency virus (FIV), and bovine immunodeficiency virus (BIV). Additionally, TRIM5 plays a crucial role in regulating autophagy by activating the autophagy regulator BECN1, causing its dissociation from inhibitors BCL2 and TAB2. Furthermore, TRIM5 acts as a selective autophagy receptor, recognizing and targeting HIV-1 capsid protein p24 for autophagic degradation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P16860 (H27-H134)

Gene ID
Molecular Construction
N-term
6*His
NPPB (H27-H134)
Accession # P16860
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Natriuretic Peptides B; Gamma-Brain Natriuretic Peptide; NPPB
AA Sequence

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, 20% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

NPPB Protein, Human (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NPPB Protein, Human (His, solution)
Cat. No.:
HY-P71119
Quantity:
MCE Japan Authorized Agent: