1. Recombinant Proteins
  2. Others
  3. Norrin Protein, Human

Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1). It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1). It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free.

Background

Norrin Protein, as a vital player in the canonical Wnt signaling pathway, activates this pathway by engaging the FZD4 and LRP5 coreceptor complex. Its significance lies in its central role in retinal vascularization, as it acts as a ligand for FZD4, resulting in the stabilization of beta-catenin (CTNNB1) and the activation of LEF/TCF-mediated transcriptional programs. Additionally, Norrin Protein collaborates with TSPAN12 to independently activate FZD4, suggesting the existence of a Wnt-independent signaling mechanism that also contributes to the accumulation of beta-catenin (CTNNB1). Furthermore, Norrin Protein may participate in a pathway that regulates neural cell differentiation and proliferation, and it potentially plays a role in neuroectodermal cell-cell interactions. It forms homodimers through disulfide linkages and is part of a complex consisting of TSPAN12, FZD4, LRP5/6, and norrin itself (NDP). Notably, Norrin Protein exhibits a high affinity for binding to FZD4 and interacts with LRP6, specifically with its Beta-propellers 1 and 2.

Biological Activity

Measured by its binding ability in a functional ELISA. When Human Norrin is coated at 0.5 μg/mL (100 μL/well) can bind Human Frizzled­4. The ED50 for this effect is 86.34 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Human Norrin is coated at 0.5 μg/mL (100 μL/well) can bind Human Frizzled­4. The ED50 for this effect is 86.34 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q00604 (K25-S133)

Gene ID
Molecular Construction
N-term
Norrin (K25-S133)
Accession # Q00604
C-term
Synonyms
Norrin; NDP; Norrie disease protein; X-linked exudative vitreoretinopathy 2 protein; EVR2
AA Sequence

KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Molecular Weight

Approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCL, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Norrin Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Norrin Protein, Human
Cat. No.:
HY-P79124
Quantity:
MCE Japan Authorized Agent: