NODAL Protein, Human

Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. NODAL Protein, Human is the recombinant human-derived NODAL protein, expressed by E. coli, with tag free.

Nodal protein plays a pivotal role in embryonic development, serving as an indispensable factor for both mesoderm formation and axial patterning. As a homodimer held together by disulfide linkages, Nodal contributes to the molecular framework that governs essential developmental pathways, ensuring the proper establishment of mesodermal tissues and axial structures during embryogenesis. This protein, free from animal-derived components, underscores its suitability for applications demanding stringent purity and ethical considerations in research and biotechnological endeavors.

Immobilized Human NODAL Protein, Tag Free at 10 μg/mL (100 μL/well) can bind Human SIRP gamma, Fc Tag with a linear range of 0.01-0.625 μg/mL.

Human

E. coli

Tag Free

Q96S42 (H238-L347)

4838

Full Length of Mature Protein

HLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

Approximately 14-15 kDa,based on SDS-PAGE under reducing conditions.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution in 10 mM Sodium citrate, pH3.0 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.