1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. NME1/NDPKA Protein, Human (His)

The NME1/NDPKA protein plays a crucial role in the synthesis of nucleoside triphosphates and exhibits multiple activities, including nucleoside diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease functions. NME1/NDPKA Protein, Human (His) is the recombinant human-derived NME1/NDPKA protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NME1/NDPKA protein plays a crucial role in the synthesis of nucleoside triphosphates and exhibits multiple activities, including nucleoside diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease functions. NME1/NDPKA Protein, Human (His) is the recombinant human-derived NME1/NDPKA protein, expressed by E. coli , with N-6*His labeled tag.

Background

NME1/NDPKA Protein plays a major role in synthesizing nucleoside triphosphates, excluding ATP. It utilizes a ping-pong mechanism, transferring the ATP gamma phosphate to the NDP beta phosphate via a phosphorylated active-site intermediate. The protein exhibits diverse activities, including nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl/farnesyl pyrophosphate kinase, histidine protein kinase, and 3'-5' exonuclease. NME1 is crucial for cell proliferation, differentiation, development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. It is essential for neural development, impacting neural patterning and cell fate determination. In GZMA-mediated cell death, NME1 collaborates with TREX1, nicking one DNA strand and enhancing DNA damage to prevent rapid repair and reannealing.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P15531-1 (M1-E152)

Gene ID
Molecular Construction
N-term
6*His
NME1 (M1-E152)
Accession # P15531-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
rHuNucleoside diphosphate kinase A/NDPKA, His; Nucleoside Diphosphate Kinase A; NDK A; NDP Kinase A; Granzyme A-Activated DNase; GAAD; Metastasis Inhibition Factor nm23; Tumor Metastatic Process-Associated Protein; nm23-H1; NME1; NDPKA; NM23
AA Sequence

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

NME1/NDPKA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NME1/NDPKA Protein, Human (His)
Cat. No.:
HY-P70299
Quantity:
MCE Japan Authorized Agent: