1. Recombinant Proteins
  2. Receptor Proteins
  3. NKp46/NCR1 Protein, Human (HEK293, Fc)

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function. NKp46/NCR1 Protein, Human (HEK293, Fc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

NKp46/NCR1 Protein, Human (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function[1][2][3]. NKp46/NCR1 Protein, Human (HEK293, Fc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

NKp46 is a ~46 kDa type 1 transmembrane glycoprotein characterized by a 30 a.a. intracellular tail, 20 a.a. transmembrane domain, and two extracellular Ig-like domains that are contacted through a 25 a.a short peptide. NKp46 is a novel triggering receptor that is involved in natural cytotoxicity[1].
NKp46 is uniquely expressed on all NK cell subsets and has been suggested as a possible target for NK cell ablation and as a pan NK cell marker. Distinct among the NCRs, NKp46 (NCR1) is evolutionary conserved between mice and humans. knock-down of NKp46 in primary human NK cells decreased recruitment of F-actin to the synapse[1].
NKp46 contributes to clearance of Streptococcus pneumoniae by interacting with infected alveolar macrophages. Targeting of NK cells using an NKp46 antibody can attenuate type 1 diabetes progression in mice. NKp46 also regulates graft-versus-host disease and allergic response. Following the initiation of an NK-target cell interaction, NKp46 clusters at the cell membrane, specifically at the immune synapse. At the immune synapse, NKp46 mediates cytoskeletal rearrangement and cellular polarization[1].
Cross-linking of NKp46 led to a strong NK cell activation resulting in induction of Ca2+ mobilization, cytotoxicity and lymphokine release[2].
The natural cytotoxicity receptor (NCR) family that includes NKp30, NKp44, and NKp46 is the biggest family of activating human NK-cell receptors. NKp46 is the only NCR member that has a mouse orthologue, named Ncr1. The first ligand identified for NKp46/NCR1 receptors is the hemagglutinin (HA) protein of influenza virus[3].

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O76036-6/AAH64806 (Q22-D254)

Gene ID
Molecular Construction
N-term
NKp46 (Q22-D254)
Accession # AAH64806
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
rHuNatural Cytotoxicity Triggering Receptor 1/NCR1, Fc; Natural cytotoxicity triggering receptor 1; Lymphocyte antigen 94 homolog; NK cell-activating receptor; Natural killer cell p46-related protein; NK-p46; NKp46; hNKp46; CD335; NCR1; LY94;
AA Sequence

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

Molecular Weight

Approximately 66.0 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKp46/NCR1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp46/NCR1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70174
Quantity:
MCE Japan Authorized Agent: