1. Recombinant Proteins
  2. CD Antigens Biotinylated Proteins
  3. NK Cell CD Proteins
  4. NKG2A/CD159a
  5. NKG2A Protein, Human (Biotinylated, HEK293, His-Avi)

NKG2A Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78182
Handling Instructions Technical Support

The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKG2A protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKG2A protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

NKG2A Protein, an immune inhibitory receptor crucial for self-nonself discrimination, forms a complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides from the signal sequence of classical MHC class Ia molecules. This recognition allows cytotoxic cells to monitor MHC class I expression in healthy cells and promotes self-tolerance. Upon binding to HLA-E-peptide complexes, NKG2A transmits intracellular signals through two immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHP-1 and INPPL1/SHP-2 tyrosine phosphatases to oppose signals from activating receptors. As a key inhibitory receptor on natural killer (NK) cells, NKG2A regulates their activation and effector functions, countering T cell receptor signaling on a subset of memory/effector CD8-positive T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a phenomenon known as cell exhaustion. Notably, during viral infection, NKG2A recognizes HLA-E in complex with human cytomegalovirus-derived peptides, inhibiting NK cell cytotoxicity and facilitating viral immune escape.

Biological Activity

Immobilized Anti-NKG2A Antibody hFc at 2 μg/mL (100 μL/Well) on the plate. Dose response curve for Biotinylated Human NKG2A His with the EC50 of 0.21-0.23 μg/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

N-His;N-Avi

Accession

P26715-1 (R100-L233)

Gene ID
Molecular Construction
N-term
His-Avi
NKG2A (R100-L233)
Accession # P26715-1
C-term
Protein Length

Partial

Synonyms
NKG2-A/NKG2-B type II integral membrane protein; CD159a; KLRC1
AA Sequence

RHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Molecular Weight

32-48 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKG2A Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2A Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78182
Quantity:
MCE Japan Authorized Agent: