1. Recombinant Proteins
  2. Others
  3. NIP7 Protein, Human (His)

NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag.

Background

NIP7 plays an essential role in ensuring the accurate processing of 34S pre-rRNA and the assembly of the 60S ribosome subunit. Operating as a monomer, NIP7 interacts with the pre-ribosome complex, potentially binding to RNA and engaging in crucial interactions with various protein partners such as NOL8, SBDS, and FTSJ3. These interactions contribute to the intricate network of molecular events involved in the maturation and assembly of ribosomal subunits, highlighting the significance of NIP7 in the complex machinery of ribosome biogenesis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y221-1 (M1-T180)

Gene ID
Molecular Construction
N-term
6*His
NIP7 (M1-T180)
Accession # Q9Y221-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
60S Ribosome Subunit Biogenesis Protein NIP7 Homolog; KD93; NIP7
AA Sequence

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Predicted Molecular Mass
22.6 kDa
Molecular Weight

Approximately 20 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NIP7 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NIP7 Protein, Human (His)
Cat. No.:
HY-P71162
Quantity:
MCE Japan Authorized Agent: